Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody

CAT#: TA346158

Rabbit Polyclonal Anti-CYP2D6 Antibody

Product Images

WB Suggested Anti-CYP2D6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: OVCAR-3 cell lysateCYP2D6 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the middle region of human CYP2D6. Synthetic peptide located within the following region: EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: cytochrome P450 family 2 subfamily D member 6
• Database Link:
  NP_000097
  Entrez Gene 1565 Human
  UniProt ID P10635
• Background: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to
• Synonyms: CPD6; CYP2D; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID6; P450-DB1; P450C2D; P450DB1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Horse: 92%; Mouse: 92%

Reference Data

• Protein Families: Druggable Genome, P450, Transmembrane
• Protein Pathways: Drug metabolism - cytochrome P450