Antibodies for $/€ 289

Jump to Filters
View as table Download
Deformed Epidermal Autoregulatory Factor 1 (DEAF1) Rabbit Polyclonal Antibody
TA345314

USD 475.00

5 Days

Rabbit Polyclonal Anti-DEAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the N terminal of human DEAF1. Synthetic peptide located within the following region: EEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPD
Deformed Epidermal Autoregulatory Factor 1 (DEAF1) Rabbit Polyclonal Antibody
TA345315

USD 475.00

5 Days

Rabbit Polyclonal Anti-DEAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the C terminal of human DEAF1. Synthetic peptide located within the following region: TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV