Antibodies for $/€ 289

Jump to Filters
View as table Download
Epithelial Stromal Interaction 1 (EPSTI1) Rabbit Polyclonal Antibody
TA346651

USD 475.00

5 Days

Rabbit Polyclonal Anti-EPSTI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPSTI1 antibody: synthetic peptide directed towards the N terminal of human EPSTI1. Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK