Epithelial Stromal Interaction 1 (EPSTI1) Rabbit Polyclonal Antibody

CAT#: TA346651

Rabbit Polyclonal Anti-EPSTI1 Antibody

Product Images

WB Suggested Anti-EPSTI1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EPSTI1 antibody: synthetic peptide directed towards the N terminal of human EPSTI1. Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: epithelial stromal interaction 1 (breast)
• Database Link:
  NP_001002264
  Entrez Gene 94240 Human
  UniProt ID Q96J88
• Background: EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.
• Synonyms: BRESI1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane