Antibodies for $/€ 289

Jump to Filters
View as table Download
Folate Binding Protein (FOLR1) Rabbit Polyclonal Antibody
TA346052

USD 475.00

5 Days

Rabbit Polyclonal Anti-FOLR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOLR1 antibody: synthetic peptide directed towards the middle region of human FOLR1. Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF