Folate Binding Protein (FOLR1) Rabbit Polyclonal Antibody

CAT#: TA346052

Rabbit Polyclonal Anti-FOLR1 Antibody

Product Images

WB Suggested Anti-FOLR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: PANC1 cell lysateFOLR1 is supported by BioGPS gene expression data to be expressed in PANC1

• 

  Host: Rabbit; Target Name: FOLR1; Sample Tissue: PANC1 Whole Cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/Lane; Gel Concentration: 0.12

• 

  Rabbit Anti-FOLR1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOLR1 antibody: synthetic peptide directed towards the middle region of human FOLR1. Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: folate receptor 1 (adult)
• Database Link:
  NP_000793
  Entrez Gene 2348 Human
  UniProt ID P15328
• Background: The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form.
• Synonyms: FBP; FOLR
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane