Antibodies for $/€ 289

Jump to Filters
View as table Download
TMED4 Rabbit Polyclonal Antibody
TA344030

USD 410.00

5 Days

Rabbit Polyclonal Anti-TMED4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the N terminal of human TMED4. Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
TMED4 Rabbit Polyclonal Antibody
TA344031

USD 475.00

5 Days

Rabbit Polyclonal Anti-TMED4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the middle region of human TMED4. Synthetic peptide located within the following region: DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER