TMED4 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of transmembrane emp24 protein transport domain containing 4 (TMED4)
USD 325.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "TMED4"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the N terminal of human TMED4. Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | transmembrane p24 trafficking protein 4 |
Database Link | |
Background | TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown. |
Synonyms | ERS25; GMP25iso; HNLF; p24a3; p24alpha3 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Mouse: 91%; Zebrafish: 90%; Pig: 86%; Rat: 86%; Bovine: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.