TMED4 Rabbit Polyclonal Antibody

CAT#: TA344030

Rabbit Polyclonal Anti-TMED4 Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of transmembrane emp24 protein transport domain containing 4 (TMED4)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "TMED4"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the N terminal of human TMED4. Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name transmembrane p24 trafficking protein 4
Background TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
Synonyms ERS25; GMP25iso; HNLF; p24a3; p24alpha3
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Mouse: 91%; Zebrafish: 90%; Pig: 86%; Rat: 86%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.