Rabbit Polyclonal Anti-TMED4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the N terminal of human TMED4. Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT |
Rabbit Polyclonal Anti-TMED4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the middle region of human TMED4. Synthetic peptide located within the following region: DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER |
Rabbit Polyclonal Anti-TMED4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMED4 |
TMED4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMED4 |
Germany
Japan
United Kingdom
China
