Antibodies for $/€ 289

Jump to Filters
View as table Download
PCBP1 Rabbit Polyclonal Antibody
TA345948

USD 410.00

5 Days

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBP1 antibody: synthetic peptide directed towards the middle region of human PCBP1. Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM