PCBP1 Rabbit Polyclonal Antibody

CAT#: TA345948

Rabbit Polyclonal Anti-PCBP1 Antibody

Product Images

WB Suggested Anti-PCBP1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysatePCBP1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: PCBP1; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 2.5 ug/mL; Peptide Concentration: 2.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration: 12%PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCBP1 antibody: synthetic peptide directed towards the middle region of human PCBP1. Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: poly(rC) binding protein 1
• Database Link:
  NP_006187
  Entrez Gene 23983 MouseEntrez Gene 5093 Human
  UniProt ID Q15365
• Background: PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. PCBP1 is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.This intronless gene is thought to be generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.
• Synonyms: HEL-S-85; hnRNP-E1; hnRNP-X; HNRPE1; HNRPX
• Note: Immunogen Sequence Homology: Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%

Reference Data

• Protein Pathways: Spliceosome