Antibodies for $/€ 289

Jump to Filters
View as table Download
Il17b Rabbit Polyclonal Antibody
TA344096

USD 475.00

5 Days

Rabbit Polyclonal Anti-Il17b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Il17b antibody is: synthetic peptide directed towards the N-terminal region of Rat Il17b. Synthetic peptide located within the following region: LLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARM