Il17b Rabbit Polyclonal Antibody

CAT#: TA344096

Rabbit Polyclonal Anti-Il17b Antibody

Product Images

Host: Rabbit; Target Name: Il17b; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Il17b antibody is: synthetic peptide directed towards the N-terminal region of Rat Il17b. Synthetic peptide located within the following region: LLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: interleukin 17B
• Database Link:
  NP_446241
  Entrez Gene 116472 Rat
• Background: Human homolog is a T cell-derived cytokine that may be involved in the proinflammatory response.
• Synonyms: IL-17B; IL-20; IL20; Interleukin-20; MGC138900; MGC138901; NIRF; ZCYTO7
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 92%; Rabbit: 85%; Yeast: 79%