Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-GPATCH2 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gpatc2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Gpatc2. Synthetic peptide located within the following region: DELRSESDSSSLSSTDAGLFTNDEGRQVFILIVRNFKVRSPSKGKLMSGN

Rabbit Polyclonal Anti-GPATCH2 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gpatch2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gpatch2. Synthetic peptide located within the following region: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV