Antibodies for $/€ 289

Jump to Filters
View as table Download
PHAP1 (ANP32A) Rabbit Polyclonal Antibody
TA345682

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANP32A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE
PHAP1 (ANP32A) Rabbit Polyclonal Antibody
TA345683

USD 410.00

5 Days

Rabbit Polyclonal Anti-ANP32A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the N terminal of human ANP32A. Synthetic peptide located within the following region: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI