Antibodies for $/€ 289

Jump to Filters
View as table Download
Gemin 2 (GEMIN2) Rabbit Polyclonal Antibody
TA345721

USD 475.00

5 Days

Rabbit Polyclonal Anti-SIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1. Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Gemin2 Rabbit Polyclonal Antibody
TA345722

USD 475.00

5 Days

Rabbit Polyclonal Anti-Sip1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sip1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEG