Gemin 2 (GEMIN2) Rabbit Polyclonal Antibody

CAT#: TA345721

Rabbit Polyclonal Anti-SIP1 Antibody

Product Images

WB Suggested Anti-SIP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate.GEMIN2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• 

  Host: Rabbit; Target Name: GEMIN2; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml.GEMIN2 is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: GEMIN2; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml.GEMIN2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1. Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: gem nuclear organelle associated protein 2
• Database Link:
  NP_001009182
  Entrez Gene 8487 Human
  UniProt ID O14893
• Background: Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
• Synonyms: SIP1; SIP1-delta
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency