Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-ST8SIA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST8SIA4 antibody: synthetic peptide directed towards the middle region of human ST8SIA4. Synthetic peptide located within the following region: DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM

Rabbit Polyclonal Anti-St8sia4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-St8sia4 antibody is: synthetic peptide directed towards the C-terminal region of Rat St8sia4. Synthetic peptide located within the following region: GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA