St8sia4 Rabbit Polyclonal Antibody

CAT#: TA346744

Rabbit Polyclonal Anti-St8sia4 Antibody

Product Images

WB Suggested Anti-St8sia4 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-St8sia4 antibody is: synthetic peptide directed towards the C-terminal region of Rat St8sia4. Synthetic peptide located within the following region: GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
• Database Link:
  NP_446366
  Entrez Gene 116696 Rat
• Background: enzyme involved in polysialylation of N-CAM [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AM419015.1, U90215.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160565, ERS240718 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: MGC34450; MGC61459; polysialyltransferase-1; PST; PST1; SIAT8D; ST8SIA-IV
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%