Antibodies for $/€ 289

Jump to Filters
View as table Download
AGXT2 Rabbit Polyclonal Antibody
TA346847

USD 475.00

5 Days

Rabbit Polyclonal Anti-AGXT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGXT2 antibody: synthetic peptide directed towards the N terminal of human AGXT2. Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK