AGXT2 Rabbit Polyclonal Antibody

CAT#: TA346847

Rabbit Polyclonal Anti-AGXT2 Antibody

Product Images

WB Suggested Anti-AGXT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGXT2 antibody: synthetic peptide directed towards the N terminal of human AGXT2. Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: alanine--glyoxylate aminotransferase 2
• Database Link:
  NP_114106
  Entrez Gene 64902 Human
  UniProt ID Q9BYV1
• Background: The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. [provided by RefSeq, Dec 2008]
• Synonyms: AGT2; DAIBAT
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Dog: 79%; Rat: 79%; Horse: 79%; Rabbit: 79%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism