Antibodies for $/€ 289

Jump to Filters
View as table Download
Cytochrome p450 2C19 (CYP2C19) Rabbit Polyclonal Antibody
TA346224

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-CYP2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD