Cytochrome p450 2C19 (CYP2C19) Rabbit Polyclonal Antibody
USD 867.00
USD 495.00
USD 159.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 56 kDa |
Gene Name | cytochrome P450 family 2 subfamily C member 19 |
Database Link | |
Background | CYP2C19 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | CPCJ; CYP2C; CYPIIC17; CYPIIC19; P450C2C; P450IIC19 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Dog: 86%; Sheep: 86%; Bovine: 86%; Guinea pig: 86%; Goat: 75% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Arachidonic acid metabolism, Drug metabolism - cytochrome P450, Linoleic acid metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review