Antibodies for $/€ 289

Jump to Filters
View as table Download
Claudin18 (CLDN18) Rabbit Polyclonal Antibody
TA346056

USD 475.00

5 Days

Rabbit Polyclonal Anti-CLDN18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE