Claudin18 (CLDN18) Rabbit Polyclonal Antibody

CAT#: TA346056

Rabbit Polyclonal Anti-CLDN18 Antibody

Product Images

WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: CLDN18; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 0.12

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: claudin 18
• Database Link:
  NP_001002026
  Entrez Gene 51208 Human
  UniProt ID P56856
• Background: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001). [supplied by OMIM]
• Synonyms: SFTA5; SFTPJ
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 85%; Dog: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction