Antibodies for $/€ 289

Jump to Filters
View as table Download
Prothrombin (F2) Rabbit Polyclonal Antibody
TA346199

USD 475.00

5 Days

Rabbit Polyclonal Anti-F2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR