Prothrombin (F2) Rabbit Polyclonal Antibody

CAT#: TA346199

Rabbit Polyclonal Anti-F2 Antibody

Product Images

WB Suggested Anti-F2 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: coagulation factor II, thrombin
• Database Link:
  NP_000497
  Entrez Gene 29251 Rat
  UniProt ID P00734
• Background: F2 catalyzes the preferential cleavage of Arg-Gly; activates fibrinogen to fibrin and releases fibrinopeptides A and B; involved in blood coagulation and wound repair.
• Synonyms: PT; RPRGL2; THPH1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Sheep: 93%; Pig: 92%; Rat: 86%; Rabbit: 86%; Guinea pig: 80%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein
• Protein Pathways: Complement and coagulation cascades, Neuroactive ligand-receptor interaction, Regulation of actin cytoskeleton