Antibodies for $/€ 289

Jump to Filters
View as table Download
PGC1 alpha (PPARGC1A) Rabbit Polyclonal Antibody
TA343708

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPARGC1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS