Rabbit Polyclonal Anti-RBPJL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBPJL antibody is: synthetic peptide directed towards the N-terminal region of Human RBPJL. Synthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT |
Rabbit Polyclonal Anti-PCAF Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCAF antibody: synthetic peptide directed towards the C terminal of human PCAF. Synthetic peptide located within the following region: PGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSI |
Rabbit Polyclonal Anti-MFNG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFNG antibody: synthetic peptide directed towards the middle region of human MFNG. Synthetic peptide located within the following region: MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL |
Rabbit Polyclonal Anti-MFNG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFNG antibody: synthetic peptide directed towards the C terminal of human MFNG. Synthetic peptide located within the following region: QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP |
Germany
Japan
United Kingdom
China