Manic Fringe (MFNG) Rabbit Polyclonal Antibody

CAT#: TA346710

Rabbit Polyclonal Anti-MFNG Antibody

Product Images

WB Suggested Anti-MFNG Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MFNG antibody: synthetic peptide directed towards the C terminal of human MFNG. Synthetic peptide located within the following region: QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
• Database Link:
  NP_002396
  Entrez Gene 4242 Human
  UniProt ID O00587
• Background: This gene is a member of the fringe gene family which also includes radical and lunatic fringe genes. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. [provided by RefSeq, Oct 2009]
• Synonyms: 3-N-acetylglucosaminyltransferase manic fringe; beta-1; manic fringe homolog; MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; OTTHUMP00000043697; OTTHUMP00000043698; OTTHUMP00000043700
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 92%; Bovine: 92%; Guinea pig: 85%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Notch signaling pathway