Antibodies for $/€ 289

Jump to Filters
View as table Download
PAPSS2 Rabbit Polyclonal Antibody
TA346730

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAPSS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN