PAPSS2 Rabbit Polyclonal Antibody

CAT#: TA346730

Rabbit Polyclonal Anti-PAPSS2 Antibody

Product Images

WB Suggested Anti-PAPSS2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate

• 

  Host: Rabbit; Target Name: PAPSS2; Sample Tissue: Human Hela; Antibody Dilution: 1.0 ug/ml.PAPSS2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

• 

  Host: Rabbit; Target Name: PAPSS2; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml.There is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• Database Link:
  NP_001015880
  Entrez Gene 9060 Human
  UniProt ID O95340
• Background: Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: ATPSK2; BCYM4; SK2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism, Selenoamino acid metabolism, Sulfur metabolism