Antibodies for $/€ 289

Jump to Filters
View as table Download
EPB41 Rabbit Polyclonal Antibody
TA346379

USD 475.00

5 Days

Rabbit Polyclonal Anti-EPB41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the middle region of human EPB41. Synthetic peptide located within the following region: QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK