EPB41 Rabbit Polyclonal Antibody

CAT#: TA346379

Rabbit Polyclonal Anti-EPB41 Antibody

Product Images

WB Suggested Anti-EPB41 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the middle region of human EPB41. Synthetic peptide located within the following region: QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: erythrocyte membrane protein band 4.1
• Database Link:
  NP_004428
  Entrez Gene 2035 Human
  UniProt ID P11171
• Background: Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of
• Synonyms: 4.1R; EL1; HE
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Bovine: 83%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%; Yeast: 75%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Tight junction