Antibodies for $/€ 289

Jump to Filters
View as table Download
ALDH1B1 Rabbit Polyclonal Antibody
TA344350

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL