Antibodies for $/€ 289

Jump to Filters
View as table Download
Septin 2 (SEPT2) Rabbit Polyclonal Antibody
TA345164

USD 475.00

5 Days

Rabbit Polyclonal Anti-SEPT2 Antibody

Applications WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK