Septin 2 (SEPT2) Rabbit Polyclonal Antibody

CAT#: TA345164

Rabbit Polyclonal Anti-SEPT2 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Frequently bought together (2)
Transient overexpression lysate of septin 2 (SEPT2), transcript variant 2
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SEPTIN2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Monkey, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 41 kDa
Gene Name septin 2
Background SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.
Synonyms DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 90%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.