Septin 2 (SEPT2) Rabbit Polyclonal Antibody

CAT#: TA345164

Rabbit Polyclonal Anti-SEPT2 Antibody

Product Images

WB Suggested Anti-SEPT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate.SEPT2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• 

  Sample Type:??. Human Cervical Cancer Cell Lysate (15ug); 2. Monkey Fibroblast Cell Lysate (15ug); Primary Dilution:??:1000; Secondary Antibody: goat anti-Rabbit; Secondary Dilution:??:40,000;

• 

  Host: Rabbit; Target Name: 41154; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: 41154; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; SEPT2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Host: Rabbit; Target Name: 41154; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml; SEPT2 is supported by BioGPS gene expression data to be expressed in HEK293T

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Monkey, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: septin 2
• Database Link:
  NP_006146
  Entrez Gene 18000 MouseEntrez Gene 4735 Human
  UniProt ID Q15019
• Background: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.
• Synonyms: DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 90%