Antibodies for $/€ 289

Jump to Filters
View as table Download
Elf3 Rabbit Polyclonal Antibody
TA345655

USD 475.00

5 Days

Rabbit Polyclonal Anti-Elf3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of mouse Elf3. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP