Elf3 Rabbit Polyclonal Antibody

CAT#: TA345655

Rabbit Polyclonal Anti-Elf3 Antibody

Product Images

WB Suggested Anti-Elf3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Trachea

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of mouse Elf3. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: E74-like factor 3
• Database Link:
  NP_031947
  Entrez Gene 13710 Mouse
  UniProt ID Q3UPW2
• Background: Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
• Synonyms: EPR-1; ERT; ESE-1; ESX; JEN; OTTHUMP00000034052
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Dog: 86%; Horse: 86%; Pig: 79%; Human: 79%; Bovine: 79%; Rabbit: 79%