Antibodies for $/€ 289

Jump to Filters
View as table Download
ZNF281 Rabbit Polyclonal Antibody
TA343703

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF281 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF281 antibody: synthetic peptide directed towards the middle region of human ZNF281. Synthetic peptide located within the following region: PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR