ZNF281 Rabbit Polyclonal Antibody

CAT#: TA343703

Rabbit Polyclonal Anti-ZNF281 Antibody

Product Images

WB Suggested Anti-ZNF281 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF281 antibody: synthetic peptide directed towards the middle region of human ZNF281. Synthetic peptide located within the following region: PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: zinc finger protein 281
• Database Link:
  NP_036614
  Entrez Gene 23528 Human
  UniProt ID Q9Y2X9
• Background: ZNF281 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF281 may be involved in transcriptional regulation. It represses the transcription of a number of genes including gastrin and ornithine decarboxylase. ZNF281 binds to the G-rich box in the enhancer region of these genes.
• Synonyms: ZBP-99; ZNP-99
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transcription Factors