Primary Antibodies

View as table Download

Rabbit anti-ETS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human ETS1

Rabbit Polyclonal Anti-ETS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN