ETS1 Rabbit Polyclonal Antibody

CAT#: TA330028

Rabbit Polyclonal Anti-ETS1 Antibody

Product Images

WB Suggested Anti-ETS1 Antibody Titration: 1.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

• 

  Human Pancrease

• 

  Rabbit Anti-ETS1 Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: ETS proto-oncogene 1, transcription factor
• Database Link:
  NP_005229
  Entrez Gene 2113 Human
  UniProt ID P14921
• Background: ETS-1 is a member of the ets family of transcription factors, which are key mediators of physiological and pathological processes.
• Synonyms: ETS-1; EWSR2; p54
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Goat: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 84%; African clawed frog: 76%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma