Primary Antibodies

Jump to Filters
View as table Download
KCNQ1 Rabbit Polyclonal Antibody
TA337729

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA336689

USD 479.00

5 Days

Rabbit Polyclonal beta-Actin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].