Primary Antibodies

View as table Download

Rabbit Polyclonal Blimp-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Blimp-1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Blimp-1.

Rabbit Polyclonal Anti-PRDM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES