Rabbit Polyclonal Blimp-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Blimp-1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Blimp-1. |
Rabbit Polyclonal Blimp-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Blimp-1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Blimp-1. |
Rabbit Polyclonal Anti-PRDM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES |