Primary Antibodies

Jump to Filters
View as table Download
STK3 Rabbit Polyclonal Antibody
TA346751

USD 410.00

5 Days

Rabbit Polyclonal Anti-STK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
STK3 Rabbit Polyclonal Antibody
TA351035

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK3/STK4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK3/STK4
STK3 Rabbit Polyclonal Antibody
TA385350

USD 380.00

4 Weeks

STK3 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human STK3