Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-AADAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

Rabbit anti-AADAT polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human AADAT.

Rabbit Polyclonal Anti-AADAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the middle region of human AADAT. Synthetic peptide located within the following region: EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI

Aminoadipate aminotransferase (AADAT) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 203-232 amino acids from the Central region of human AADAT

AADAT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-429 of human AADAT (NP_001273611.1).
Modifications Unmodified

AADAT Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-429 of human AADAT (NP_001273611.1).
Modifications Unmodified