Rabbit Polyclonal Anti-ATG4D Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4D antibody: synthetic peptide directed towards the middle region of human ATG4D. Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP |
Rabbit polyclonal anti-ATG4D antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ATG4D. |
ATG4D Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human ATG4D (NP_116274.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
