ATG4D Rabbit Polyclonal Antibody

CAT#: TA344179

Rabbit Polyclonal Anti-ATG4D Antibody - middle region

Product Images

WB Suggested Anti-ATG4D Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HCT15 cell lysate

• 

  Lane 1: 20ug 143B lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondary Antibody Dilution : 1:10,000; Gene Name : ATG4D; Submitted by : Luis Anton, Universidad Autonoma de Madrid

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATG4D antibody: synthetic peptide directed towards the middle region of human ATG4D. Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: autophagy related 4D cysteine peptidase
• Database Link:
  NP_116274
  Entrez Gene 84971 Human
  UniProt ID Q86TL0
• Background: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases.
• Synonyms: APG4-D; APG4D; AUTL4
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%; Mouse: 90%

Reference Data

• Protein Pathways: Regulation of autophagy