Primary Antibodies

View as table Download

DAPP1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-DAPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG

Rabbit Polyclonal Anti-DAPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD

DAPP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DAPP1

DAPP1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human DAPP1 (NP_055210.2).
Modifications Unmodified

Phospho-DAPP1-Y139 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y139 of human DAPP1.
Modifications Phospho Y139